Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB4 Rabbit Polyclonal Antibody (HRP)

LILRB4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ILT3, LIR5, CD85K, ILT-3, LIR-5

UniProt

Q8NHJ6

Immunogen

The immunogen for Anti-LILRB4 antibody is: synthetic peptide directed towards the C-terminal region of Human LIRB4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RQGKHRTLAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAV

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (Kap-56), Biotin conjugate, 0.1mg/mL
BNCB0859-100 1x 100 µL

Human Kappa Light Chain (Kap-56), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Debenzoyl-2-tigloyl 10-Deacetyl Baccatin III
TRC-D203500-10MG 10 mg

2-Debenzoyl-2-tigloyl 10-Deacetyl Baccatin III

Sign In for Pricing
View Details
Mouse ANXA2 (Annexin A2) CLIA Kit
E-CL-M0085-01 24 Tests

Mouse ANXA2 (Annexin A2) CLIA Kit

Sign In for Pricing
View Details
Mouse ANXA2 (Annexin A2) CLIA Kit
E-CL-M0085-02 48 Tests

Mouse ANXA2 (Annexin A2) CLIA Kit

Sign In for Pricing
View Details
Mouse ANXA2 (Annexin A2) CLIA Kit
E-CL-M0085-03 96 Tests

Mouse ANXA2 (Annexin A2) CLIA Kit

Sign In for Pricing
View Details
CELA3B (CELA3B/1218), CF640R conjugate, 0.1mg/mL
BNC401218-500 1x 500 µL

CELA3B (CELA3B/1218), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details