Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTRR Rabbit Polyclonal Antibody (FITC)

MTRR Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MSR, cblE

UniProt

Q9UBK8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MTRR

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LQPNIHASHEDSGKALAPKISISPRTTNSFHLPDDPSIPIIMVGPGTGIA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1306583 3'UTR Luciferase Stable Cell Line
TU217650 1.0 mL

RGD1306583 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Hepatitis B - surface antigen
MBS324128-01 1 mL

Hepatitis B - surface antigen

Sign In for Pricing
View Details
Hepatitis B - surface antigen
MBS324128-02 5x 1 mL

Hepatitis B - surface antigen

Sign In for Pricing
View Details
Rabbit Polyclonal DISC1 Antibody [Allophycocyanin]
NB110-40775APC 0.1 mL

Rabbit Polyclonal DISC1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
ZHX3 (Zinc Fingers and Homeoboxes Protein 3, Zinc Finger and Homeodomain Protein 3, KIAA0395, Triple Homeobox Protein 1, TIX1)
MBS644606-01 0.05 mg

ZHX3 (Zinc Fingers and Homeoboxes Protein 3, Zinc Finger and Homeodomain Protein 3, KIAA0395, Triple Homeobox Protein 1, TIX1)

Sign In for Pricing
View Details
ZHX3 (Zinc Fingers and Homeoboxes Protein 3, Zinc Finger and Homeodomain Protein 3, KIAA0395, Triple Homeobox Protein 1, TIX1)
MBS644606-02 5x 0.05 mg

ZHX3 (Zinc Fingers and Homeoboxes Protein 3, Zinc Finger and Homeodomain Protein 3, KIAA0395, Triple Homeobox Protein 1, TIX1)

Sign In for Pricing
View Details