Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYO5A Rabbit Polyclonal Antibody (FITC)

MYO5A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GS1, MYO5, MYH12, MYR12

UniProt

Q9Y4I1

Immunogen

The immunogen is a synthetic peptide directed towards the Middle region of Human MYO5A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSRTEEPSEKKVPL

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

201 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensin Converting Enzyme 2 (ACE2) (N-term) Rabbit Polyclonal Antibody
AP13058PU-N 400 µL

Angiotensin Converting Enzyme 2 (ACE2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CAmLG (NM_001745) Human Over-expression Lysate
LC419768 20 µg

CAmLG (NM_001745) Human Over-expression Lysate

Sign In for Pricing
View Details
CD45RO (UCHL1 + T200/797), 0.2mg/mL
BNUB1209-100 1x 100 µL

CD45RO (UCHL1 + T200/797), 0.2mg/mL

Sign In for Pricing
View Details
DNMT3L Mouse Monoclonal Antibody [B0-5]
M1405-4 100 µL

DNMT3L Mouse Monoclonal Antibody [B0-5]

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF640R conjugate, 0.1mg/mL
BNC401729-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Rat CD3 Antibody[G4.18]
E-AB-F1228UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Rat CD3 Antibody[G4.18]

Sign In for Pricing
View Details