Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEK2 Rabbit Polyclonal Antibody (HRP)

NEK2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NLK1, RP67, NEK2A, HsPK21, PPP1R111

UniProt

P51955

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NEK2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADRM1/ARM-1/ARM Rabbit Polyclonal Antibody (Fluoro550)
orb3106612 100 µg

ADRM1/ARM-1/ARM Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Camel Nucleotide-Binding Oligomerization Domain Containing 2 (NOD2) ELISA Kit
MBS9919315-01 48 Well

Camel Nucleotide-Binding Oligomerization Domain Containing 2 (NOD2) ELISA Kit

Sign In for Pricing
View Details
Camel Nucleotide-Binding Oligomerization Domain Containing 2 (NOD2) ELISA Kit
MBS9919315-02 96 Well

Camel Nucleotide-Binding Oligomerization Domain Containing 2 (NOD2) ELISA Kit

Sign In for Pricing
View Details
Camel Nucleotide-Binding Oligomerization Domain Containing 2 (NOD2) ELISA Kit
MBS9919315-03 5x 96 Well

Camel Nucleotide-Binding Oligomerization Domain Containing 2 (NOD2) ELISA Kit

Sign In for Pricing
View Details
Camel Nucleotide-Binding Oligomerization Domain Containing 2 (NOD2) ELISA Kit
MBS9919315-04 10x 96 Well

Camel Nucleotide-Binding Oligomerization Domain Containing 2 (NOD2) ELISA Kit

Sign In for Pricing
View Details
Monkey Vacuolar Protein Sorting-Associated Protein 4B (VPS4B) ELISA Kit
MBS9360766-01 48 Well

Monkey Vacuolar Protein Sorting-Associated Protein 4B (VPS4B) ELISA Kit

Sign In for Pricing
View Details