Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGRMC2 Rabbit Polyclonal Antibody (HRP)

PGRMC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DG6, PMBP

UniProt

O15173

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PGRC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psap sgRNA CRISPR Lentivector set (Mouse)
K3835501 3x 1.0 µg

Psap sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Eukaryotic Translation Initiation Factor 4 Gamma 2 (EIF4G2) Antibody
abx213539-01 50 µL

Eukaryotic Translation Initiation Factor 4 Gamma 2 (EIF4G2) Antibody

Sign In for Pricing
View Details
Eukaryotic Translation Initiation Factor 4 Gamma 2 (EIF4G2) Antibody
abx213539-02 100 µL

Eukaryotic Translation Initiation Factor 4 Gamma 2 (EIF4G2) Antibody

Sign In for Pricing
View Details
PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, CAS601A-1, PIN200A-1, PIN510A-1, & PIN600A-1)
PIN412A-KIT 1 Kit

PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, CAS601A-1, PIN200A-1, PIN510A-1, & PIN600A-1)

Sign In for Pricing
View Details
ROR2 Rabbit mAb
56653 50 µL

ROR2 Rabbit mAb

Sign In for Pricing
View Details
IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) discontinued
301376 100 µg

IL18BP (ILBP 18, ILBP-18, IL18 BP, Interleukin 18 Binding Protein) discontinued

Sign In for Pricing
View Details