Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF4 Rabbit Polyclonal Antibody (FITC)

RASSF4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AD037

UniProt

Q9H2L5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASF4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MQDDREQVHLPSTSWMPRRPSCPLKEPSPQNGNITAQGPSIQPVHKAESS

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2B Adaptor Protein 2 (SH2B2) Antibody
abx327510-01 50 µg

SH2B Adaptor Protein 2 (SH2B2) Antibody

Sign In for Pricing
View Details
SH2B Adaptor Protein 2 (SH2B2) Antibody
abx327510-02 100 µg

SH2B Adaptor Protein 2 (SH2B2) Antibody

Sign In for Pricing
View Details
CD46 (AHUS2, CD46 antigen complement regulatory protein, Complement membrane cofactor protein, MCP, Measles virus receptor, Membrane cofactor protein, MIC10, TLX, Trophoblast leucocyte common antigen) (BSA & Azide Free) (MaxLight 405)
MBS6193722-01 0.1 mL

CD46 (AHUS2, CD46 antigen complement regulatory protein, Complement membrane cofactor protein, MCP, Measles virus receptor, Membrane cofactor protein, MIC10, TLX, Trophoblast leucocyte common antigen) (BSA & Azide Free) (MaxLight 405)

Sign In for Pricing
View Details
CD46 (AHUS2, CD46 antigen complement regulatory protein, Complement membrane cofactor protein, MCP, Measles virus receptor, Membrane cofactor protein, MIC10, TLX, Trophoblast leucocyte common antigen) (BSA & Azide Free) (MaxLight 405)
MBS6193722-02 5x 0.1 mL

CD46 (AHUS2, CD46 antigen complement regulatory protein, Complement membrane cofactor protein, MCP, Measles virus receptor, Membrane cofactor protein, MIC10, TLX, Trophoblast leucocyte common antigen) (BSA & Azide Free) (MaxLight 405)

Sign In for Pricing
View Details
HMGCR ELISA Kit (Human) (OKCD08514)
OKCD08514 96 Well

HMGCR ELISA Kit (Human) (OKCD08514)

Sign In for Pricing
View Details
Tensin 1 antibody
70R-50500 100 ul

Tensin 1 antibody

Sign In for Pricing
View Details