Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPB Rabbit Polyclonal Antibody (Biotin)

SNRPB Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

COD, CCMS, SNRPB1, SmB/B', Sm-B/B', snRNP-B, SmB/SmB'

UniProt

P14678

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RSMB

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCLC Rabbit Polyclonal Antibody (Fluoro488)
orb3112984 100 µg

GCLC Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
GRP94 (Endoplasmin, 94kD Glucose-regulated Protein, GRP-94, Heat Shock Protein 90kD beta Member 1, Tumor Rejection Antigen 1, gp96 Homolog, HSP90B1, TRA1 discontinued. See G3057-42
G3057-44H 50 µg

GRP94 (Endoplasmin, 94kD Glucose-regulated Protein, GRP-94, Heat Shock Protein 90kD beta Member 1, Tumor Rejection Antigen 1, gp96 Homolog, HSP90B1, TRA1 discontinued. See G3057-42

Sign In for Pricing
View Details
RpmF Antibody
orb826274 2 mg

RpmF Antibody

Sign In for Pricing
View Details
KIF1A Protein Vector (Human) (pPB-C-His)
PV053861 500 ng

KIF1A Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Crabp2 3'UTR Luciferase Stable Cell Line
TU104335 1.0 mL

Crabp2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CXorf21 Rabbit Polyclonal Antibody (BF647)
orb1608095 100 µL

CXorf21 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details