Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRPF Rabbit Polyclonal Antibody (Biotin)

SNRPF Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SMF, Sm-F, snRNP-F

UniProt

P62306

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RUXF

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_003086

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HS3ST2 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 2, Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 2, 3-OST-2, Heparan Sulfate 3-O-sulfotransferase 2, h3-OST-2, 3OST2, UNQ2442/PRO5004) (MaxLight 405)
MBS6190614-01 0.1 mL

HS3ST2 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 2, Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 2, 3-OST-2, Heparan Sulfate 3-O-sulfotransferase 2, h3-OST-2, 3OST2, UNQ2442/PRO5004) (MaxLight 405)

Sign In for Pricing
View Details
HS3ST2 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 2, Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 2, 3-OST-2, Heparan Sulfate 3-O-sulfotransferase 2, h3-OST-2, 3OST2, UNQ2442/PRO5004) (MaxLight 405)
MBS6190614-02 5x 0.1 mL

HS3ST2 (Heparan Sulfate Glucosamine 3-O-sulfotransferase 2, Heparan Sulfate D-glucosaminyl 3-O-sulfotransferase 2, 3-OST-2, Heparan Sulfate 3-O-sulfotransferase 2, h3-OST-2, 3OST2, UNQ2442/PRO5004) (MaxLight 405)

Sign In for Pricing
View Details
PLCD1, NT (PLCD1, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1, Phosphoinositide phospholipase C-delta-1, Phospholipase C-III, Phospholipase C-delta-1)
MBS6007360-01 0.2 mL

PLCD1, NT (PLCD1, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1, Phosphoinositide phospholipase C-delta-1, Phospholipase C-III, Phospholipase C-delta-1)

Sign In for Pricing
View Details
PLCD1, NT (PLCD1, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1, Phosphoinositide phospholipase C-delta-1, Phospholipase C-III, Phospholipase C-delta-1)
MBS6007360-02 5x 0.2 mL

PLCD1, NT (PLCD1, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1, Phosphoinositide phospholipase C-delta-1, Phospholipase C-III, Phospholipase C-delta-1)

Sign In for Pricing
View Details
A530054K11Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
10950114 3x 1.0 µg

A530054K11Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Connective Tissue Growth Factor (CTGF) CLIA Kit
EKN50636 96 Tests

Rabbit Connective Tissue Growth Factor (CTGF) CLIA Kit

Sign In for Pricing
View Details