SQSTM1 Rabbit Polyclonal Antibody (HRP)
SQSTM1 Rabbit Polyclonal Antibody (HRP)
Product Specifications
Product Name Alternative
P60, p62, A170, DMRV, OSIL, PDB3, ZIP3, p62B, NADGP, FTDALS3
UniProt
Q13501
Immunogen
The immunogen for Anti-SQSTM1 antibody is: synthetic peptide directed towards the C-terminal region of Human SQSTM
Clonality
Polyclonal
Conjugation
HRP
Sequence
Synthetic peptide located within the following region: TQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGEL
Field of Research
Cell Biology
Purification
Affinity purified
Form
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Molecular Weight
48 kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Human
Tested Applications
WB
Host or Source
Rabbit
Preservative
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
F6998-25B-HRP 100 µL
FRK (Fyn-Related Kinase, GTK, IYK, Nuclear Tyrosine Protein Kinase RAK, Protein Tyrosine Kinase 5, PTK5, RAK, Tyrosine Protein Kinase FRK) (HRP) discontinued
Sign In for Pricing
View Details 
MBS645827-01 0.1 mg
GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial, Glycoprotein gC1qBP, C1qBP, GC1q-R Protein, GC1QBP, Hyaluronan-binding Protein 1, HABP1, Mitochondrial Matrix Protein p32, p33, SF2P32)
Sign In for Pricing
View Details MBS645827-02 5x 0.1 mg
GC1qR (Complement Component 1 Q Subcomponent-binding Protein Mitochondrial, Glycoprotein gC1qBP, C1qBP, GC1q-R Protein, GC1QBP, Hyaluronan-binding Protein 1, HABP1, Mitochondrial Matrix Protein p32, p33, SF2P32)
Sign In for Pricing
View Details MBS2001043-01 24 Strip Well
CLIA Kit for Interferon Induced Protein With Tetratricopeptide Repeats 2 (IFIT2)
Sign In for Pricing
View Details MBS2001043-02 48 Well
CLIA Kit for Interferon Induced Protein With Tetratricopeptide Repeats 2 (IFIT2)
Sign In for Pricing
View Details MBS2001043-03 96 Well
CLIA Kit for Interferon Induced Protein With Tetratricopeptide Repeats 2 (IFIT2)
Sign In for Pricing
View Details