Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SQSTM1 Rabbit Polyclonal Antibody (HRP)

SQSTM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P60, p62, A170, DMRV, OSIL, PDB3, ZIP3, p62B, NADGP, FTDALS3

UniProt

Q13501

Immunogen

The immunogen for Anti-SQSTM1 antibody is: synthetic peptide directed towards the C-terminal region of Human SQSTM

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGEL

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-491-3p Primers
MPH01726 150 µL / 10 µM

hsa-miR-491-3p Primers

Sign In for Pricing
View Details
Rat P-selectin ELISA Kit
MBS761471-01 48 Well

Rat P-selectin ELISA Kit

Sign In for Pricing
View Details
Rat P-selectin ELISA Kit
MBS761471-02 96 Well

Rat P-selectin ELISA Kit

Sign In for Pricing
View Details
Rat P-selectin ELISA Kit
MBS761471-03 5x 96 Well

Rat P-selectin ELISA Kit

Sign In for Pricing
View Details
Rat P-selectin ELISA Kit
MBS761471-04 10x 96 Well

Rat P-selectin ELISA Kit

Sign In for Pricing
View Details
CDH19 Antibody
MBS9410316-01 0.05 mL

CDH19 Antibody

Sign In for Pricing
View Details