Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPC5 Rabbit Polyclonal Antibody (Biotin)

TRPC5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TRP5, PPP1R159

UniProt

Q9UL62

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRPC5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRRNLRSFTERNADSLIQNQ

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

107 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_036603.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Mesencephalic astrocyte-derived neurotrophic factor, MANF ELISA Kit
MBS1602201-01 48 Well

Bovine Mesencephalic astrocyte-derived neurotrophic factor, MANF ELISA Kit

Sign In for Pricing
View Details
Bovine Mesencephalic astrocyte-derived neurotrophic factor, MANF ELISA Kit
MBS1602201-02 96 Well

Bovine Mesencephalic astrocyte-derived neurotrophic factor, MANF ELISA Kit

Sign In for Pricing
View Details
Bovine Mesencephalic astrocyte-derived neurotrophic factor, MANF ELISA Kit
MBS1602201-03 5x 96 Well

Bovine Mesencephalic astrocyte-derived neurotrophic factor, MANF ELISA Kit

Sign In for Pricing
View Details
Bovine Mesencephalic astrocyte-derived neurotrophic factor, MANF ELISA Kit
MBS1602201-04 10x 96 Well

Bovine Mesencephalic astrocyte-derived neurotrophic factor, MANF ELISA Kit

Sign In for Pricing
View Details
VP7 (31-40) peptide (acetate)
HY-P5667A 1 Each

VP7 (31-40) peptide (acetate)

Sign In for Pricing
View Details
IL-17 Antibody
F42568-0.4ML 0.4 mL

IL-17 Antibody

Sign In for Pricing
View Details