Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VAV3 Rabbit Polyclonal Antibody (FITC)

VAV3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9UKW4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human VAV3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKK

Field of Research

Cardiovascular Research

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

93 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A5 (ADP/ATP Translocase 2, ADP,ATP Carrier Protein 2, ADP,ATP Carrier Protein, Fibroblast Isoform, Adenine Nucleotide Translocator 2, ANT 2, Solute Carrier Family 25 Member 5, ANT2) (MaxLight 750)
MBS6235370-01 0.1 mL

SLC25A5 (ADP/ATP Translocase 2, ADP,ATP Carrier Protein 2, ADP,ATP Carrier Protein, Fibroblast Isoform, Adenine Nucleotide Translocator 2, ANT 2, Solute Carrier Family 25 Member 5, ANT2) (MaxLight 750)

Sign In for Pricing
View Details
SLC25A5 (ADP/ATP Translocase 2, ADP,ATP Carrier Protein 2, ADP,ATP Carrier Protein, Fibroblast Isoform, Adenine Nucleotide Translocator 2, ANT 2, Solute Carrier Family 25 Member 5, ANT2) (MaxLight 750)
MBS6235370-02 5x 0.1 mL

SLC25A5 (ADP/ATP Translocase 2, ADP,ATP Carrier Protein 2, ADP,ATP Carrier Protein, Fibroblast Isoform, Adenine Nucleotide Translocator 2, ANT 2, Solute Carrier Family 25 Member 5, ANT2) (MaxLight 750)

Sign In for Pricing
View Details
Human IL11 Protein Lysate
MBS8413456-01 0.02 mg

Human IL11 Protein Lysate

Sign In for Pricing
View Details
Human IL11 Protein Lysate
MBS8413456-02 5x 0.02 mg

Human IL11 Protein Lysate

Sign In for Pricing
View Details
D3R Rabbit pAb
E47R10938 100 µL

D3R Rabbit pAb

Sign In for Pricing
View Details
P38 Antibody
orb255984 100 µL

P38 Antibody

Sign In for Pricing
View Details