Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS11 Rabbit Polyclonal Antibody (FITC)

VPS11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

END1, PEP5, HLD12, RNF108, hVPS11

UniProt

Q9H270

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human VPS11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QPDERGPCFAFEGHKLIAHWFRGYLIIVSRDRKVSPKSEFTSRDSQSSDK

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

103 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_068375.3

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NADH2/Mtnd2 Antibody Picoband® Fluoro594 Conjugated
A32839-1-Fluoro594 100 µg/Vial

Anti-NADH2/Mtnd2 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
AdmiRa-hsa-miR-138-5p Virus
mh0177 250 µL

AdmiRa-hsa-miR-138-5p Virus

Sign In for Pricing
View Details
GDAP2, Recombinant, Human, aa1-496, His-SUMO-Tag (Ganglioside-induced Differentiation-associated Protein 2)
373412-01 20 µg

GDAP2, Recombinant, Human, aa1-496, His-SUMO-Tag (Ganglioside-induced Differentiation-associated Protein 2)

Sign In for Pricing
View Details
GDAP2, Recombinant, Human, aa1-496, His-SUMO-Tag (Ganglioside-induced Differentiation-associated Protein 2)
373412-02 100 µg

GDAP2, Recombinant, Human, aa1-496, His-SUMO-Tag (Ganglioside-induced Differentiation-associated Protein 2)

Sign In for Pricing
View Details
GDAP2, Recombinant, Human, aa1-496, His-SUMO-Tag (Ganglioside-induced Differentiation-associated Protein 2)
373412-03 1 mg

GDAP2, Recombinant, Human, aa1-496, His-SUMO-Tag (Ganglioside-induced Differentiation-associated Protein 2)

Sign In for Pricing
View Details
Factor D Rabbit Polyclonal Antibody (BF680)
orb2527634 100 µL

Factor D Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details