Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS11 Rabbit Polyclonal Antibody (HRP)

VPS11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

END1, PEP5, HLD12, RNF108, hVPS11

UniProt

Q9H270

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human VPS11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPDERGPCFAFEGHKLIAHWFRGYLIIVSRDRKVSPKSEFTSRDSQSSDK

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

103 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_068375.3

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLOC1S2 Knockout HT29 Polyclonal Cells
ARG33153 1 Million

BLOC1S2 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
STAT4, CT (STAT4, Signal transducer and activator of transcription 4) (PE) discontinued
042384-PE 200 µL

STAT4, CT (STAT4, Signal transducer and activator of transcription 4) (PE) discontinued

Sign In for Pricing
View Details
Adenosine monophosphate-15N5 (dilithium)
HY-A0181S1-01 5 mg (100 mM in 137 μL Tris HCl/H2O buffer pH=7.5)

Adenosine monophosphate-15N5 (dilithium)

Sign In for Pricing
View Details
Adenosine monophosphate-15N5 (dilithium)
HY-A0181S1-02 10 mg (100 mM in 275 μL Tris HCl/H2O buffer pH=7.5)

Adenosine monophosphate-15N5 (dilithium)

Sign In for Pricing
View Details
TGF beta Receptor II Recombinant Rabbit mAb
orb2323375-01 25 µL

TGF beta Receptor II Recombinant Rabbit mAb

Sign In for Pricing
View Details
TGF beta Receptor II Recombinant Rabbit mAb
orb2323375-02 50 µL

TGF beta Receptor II Recombinant Rabbit mAb

Sign In for Pricing
View Details