Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP3 Rabbit Polyclonal Antibody (Biotin)

BMP3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BMP-3A

UniProt

P12645

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human BMP3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DEVWEERKPYKTLQAQAPEKSKNKKKQRKGPHRKSQTLQFDEQTLKKARR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001192.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2B3 Protein Vector (Mouse) (pPM-C-HA)
PV174968 500 ng

EIF2B3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Hamster Sodium/Potassium/Calcium Exchanger 3 (SLC24A3) ELISA Kit
MBS9905712-01 48 Well

Hamster Sodium/Potassium/Calcium Exchanger 3 (SLC24A3) ELISA Kit

Sign In for Pricing
View Details
Hamster Sodium/Potassium/Calcium Exchanger 3 (SLC24A3) ELISA Kit
MBS9905712-02 96 Well

Hamster Sodium/Potassium/Calcium Exchanger 3 (SLC24A3) ELISA Kit

Sign In for Pricing
View Details
Hamster Sodium/Potassium/Calcium Exchanger 3 (SLC24A3) ELISA Kit
MBS9905712-03 5x 96 Well

Hamster Sodium/Potassium/Calcium Exchanger 3 (SLC24A3) ELISA Kit

Sign In for Pricing
View Details
Hamster Sodium/Potassium/Calcium Exchanger 3 (SLC24A3) ELISA Kit
MBS9905712-04 10x 96 Well

Hamster Sodium/Potassium/Calcium Exchanger 3 (SLC24A3) ELISA Kit

Sign In for Pricing
View Details
ASF1A (Histone Chaperone ASF1A, Anti-silencing Function Protein 1 Homolog A, hAsf1, hAsf1a, CCG1-Interacting Factor A, CIA, hCIA, ASF1A, CGI-98, HSPC146)
318870-01 50 µL

ASF1A (Histone Chaperone ASF1A, Anti-silencing Function Protein 1 Homolog A, hAsf1, hAsf1a, CCG1-Interacting Factor A, CIA, hCIA, ASF1A, CGI-98, HSPC146)

Sign In for Pricing
View Details