Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX7 Rabbit Polyclonal Antibody (HRP)

CBX7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O95931

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CBX7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEA

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_783640.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKG2 Protein Vector (Rat) (pPB-C-His)
PV296138 500 ng

PRKG2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Inactivated ADV Grade 2 Antigen
VAng-Lsx0003-1mL 1 mL

Inactivated ADV Grade 2 Antigen

Sign In for Pricing
View Details
Anti-Interleukin-10 IL10 Antibody Picoband®, Dylight550 Conjugate
PA1354-Dylight550 100 µg

Anti-Interleukin-10 IL10 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
SLC7A1 Polyclonal Antibody
E914784 100 µL

SLC7A1 Polyclonal Antibody

Sign In for Pricing
View Details
Placental Protein 6 (PP6, Protein PL6, Transmembrane Protein 115, TMEM115, LUCA11.2)
131430 100 µg

Placental Protein 6 (PP6, Protein PL6, Transmembrane Protein 115, TMEM115, LUCA11.2)

Sign In for Pricing
View Details
DPPC Liposome for DNA and RNA Nanoparticles
DCDA20 2 mL

DPPC Liposome for DNA and RNA Nanoparticles

Sign In for Pricing
View Details