Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSGALNACT1 Rabbit Polyclonal Antibody (Biotin)

CSGALNACT1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ChGn, ChGn-1, SDJLABA, CSGalNAcT-1, beta4GalNAcT

UniProt

Q8TDX6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CGAT1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KRDELVEAIESALETLNSPAENSPNHRPYTASDFIEGIYRTERDKGTLYE

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

20 uL, LTS compatible tips for Rainin pipettes, non-filter, rack, sterile, low retention, 960 tips in 10 racks
1070-0811 960 Tips

20 uL, LTS compatible tips for Rainin pipettes, non-filter, rack, sterile, low retention, 960 tips in 10 racks

Sign In for Pricing
View Details
Kv5.1 Conjugated Antibody
orb1612812 100 µL

Kv5.1 Conjugated Antibody

Sign In for Pricing
View Details
OR10Z1 Blocking Peptide
MBS9625354-01 1 mg

OR10Z1 Blocking Peptide

Sign In for Pricing
View Details
OR10Z1 Blocking Peptide
MBS9625354-02 5x 1 mg

OR10Z1 Blocking Peptide

Sign In for Pricing
View Details
Anti-Histone H2B (formyl K120) Antibody (R2H53)
RHH37007 100 μg

Anti-Histone H2B (formyl K120) Antibody (R2H53)

Sign In for Pricing
View Details
Human N-terminal propeptide of Collagen alpha-1(I) chain ELISA Kit
MBS2881499-01 48 Well

Human N-terminal propeptide of Collagen alpha-1(I) chain ELISA Kit

Sign In for Pricing
View Details