Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSGALNACT1 Rabbit Polyclonal Antibody (HRP)

CSGALNACT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ChGn, ChGn-1, SDJLABA, CSGalNAcT-1, beta4GalNAcT

UniProt

Q8TDX6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CGAT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KRDELVEAIESALETLNSPAENSPNHRPYTASDFIEGIYRTERDKGTLYE

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cbfa2t2 rat monoclonal antibody, clone KT42, Aff - Purified
AM20792PU-N 200 µg

Cbfa2t2 rat monoclonal antibody, clone KT42, Aff - Purified

Sign In for Pricing
View Details
SLC38A7 CRISPR Activation Plasmid (m)
sc-433374-ACT 20 µg

SLC38A7 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Monkey Probable Ubiquitin Carboxyl-Terminal Hydrolase FAF-X (USP9X) ELISA Kit
MBS9370068-01 48 Well

Monkey Probable Ubiquitin Carboxyl-Terminal Hydrolase FAF-X (USP9X) ELISA Kit

Sign In for Pricing
View Details
Monkey Probable Ubiquitin Carboxyl-Terminal Hydrolase FAF-X (USP9X) ELISA Kit
MBS9370068-02 96 Well

Monkey Probable Ubiquitin Carboxyl-Terminal Hydrolase FAF-X (USP9X) ELISA Kit

Sign In for Pricing
View Details
Monkey Probable Ubiquitin Carboxyl-Terminal Hydrolase FAF-X (USP9X) ELISA Kit
MBS9370068-03 5x 96 Well

Monkey Probable Ubiquitin Carboxyl-Terminal Hydrolase FAF-X (USP9X) ELISA Kit

Sign In for Pricing
View Details
Monkey Probable Ubiquitin Carboxyl-Terminal Hydrolase FAF-X (USP9X) ELISA Kit
MBS9370068-04 10x 96 Well

Monkey Probable Ubiquitin Carboxyl-Terminal Hydrolase FAF-X (USP9X) ELISA Kit

Sign In for Pricing
View Details