Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Hemagglutinin component of the neurotoxin complex (ha17)

Product Specifications

Abbreviation

Recombinant Clostridium botulinum ha17 protein

Gene Name

Ha17

UniProt

A5HZZ5

Expression Region

2-146aa

Organism

Clostridium botulinum

Target Sequence

SVERTFLPNGNYNIKSIFSGSLYLNPVSKSLTFSNESSANNQKWNVEYMAENRCFKISNVAEPNKYLSYDNFGFISLDSLSNRCYWFPIKIAVNTYIMLSLNKVNELDYAWDIYDTNENILSQPLLLLPNFDIYNSNQMFKLEKI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.3 kDa

References & Citations

"Genome sequence of a proteolytic (Group I) Clostridium botulinum strain Hall A and comparative analysis of the clostridial genomes." Sebaihia M., Peck M.W., Minton N.P., Thomson N.R., Holden M.T.G., Mitchell W.J., Carter A.T., Bentley S.D., Mason D.R., Crossman L., Paul C.J., Ivens A., Wells-Bennik M.H.J., Davis I.J., Cerdeno-Tarraga A.M., Churcher C., Quail M.A., Chillingworth T. Parkhill J. Genome Res. 17:1082-1092 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSTPIP2 Human siRNA Oligo Duplex (Locus ID 9050)
SR305971 1 Kit

PSTPIP2 Human siRNA Oligo Duplex (Locus ID 9050)

Sign In for Pricing
View Details
Cd300ld5 (NM_001101657) Mouse Tagged Lenti ORF Clone
MR219356L4 10 µg

Cd300ld5 (NM_001101657) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CLDN14, CT (CLDN14, Claudin-14) (MaxLight 490)
MBS6286432-01 0.1 mL

CLDN14, CT (CLDN14, Claudin-14) (MaxLight 490)

Sign In for Pricing
View Details
CLDN14, CT (CLDN14, Claudin-14) (MaxLight 490)
MBS6286432-02 5x 0.1 mL

CLDN14, CT (CLDN14, Claudin-14) (MaxLight 490)

Sign In for Pricing
View Details
PCMV-TMEM43 (rat) -3xFLAG-Neo
BZ53620 1 Vial

PCMV-TMEM43 (rat) -3xFLAG-Neo

Sign In for Pricing
View Details
pTagBFP-N Plasmid
PVT10778 2 µg

pTagBFP-N Plasmid

Sign In for Pricing
View Details