Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DGCR8 Rabbit Polyclonal Antibody (Biotin)

DGCR8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gy1, pasha, DGCRK6, C22orf12

UniProt

Q8WYQ5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human DGCR8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFH

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_073557

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WASF3 (Wiskott-Aldrich Syndrome Protein Family Member 3, WASP Family Protein Member 3, Protein WAVE-3, Verprolin Homology Domain-containing Protein 3, KIAA0900, SCAR3, WAVE3)
W0807-05 100 µg

WASF3 (Wiskott-Aldrich Syndrome Protein Family Member 3, WASP Family Protein Member 3, Protein WAVE-3, Verprolin Homology Domain-containing Protein 3, KIAA0900, SCAR3, WAVE3)

Sign In for Pricing
View Details
ELISA Kit For Complement factor D
E1833m 96 Tests

ELISA Kit For Complement factor D

Sign In for Pricing
View Details
NT5C1B CRISPRa sgRNA lentivector (set of three targets)(Mouse)
32219124 3x 1.0µg DNA

NT5C1B CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
1700001L19Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)
10115094 4x 500 ng

1700001L19Rik-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
LGALS3BP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B1]
TA503459BM 100 µL

LGALS3BP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B1]

Sign In for Pricing
View Details
EWSR1 Mouse Monoclonal Antibody (Carrier-free)
orb3085765 100 µg

EWSR1 Mouse Monoclonal Antibody (Carrier-free)

Sign In for Pricing
View Details