Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMC1 Rabbit Polyclonal Antibody (HRP)

DMC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DMC1H, LIM15, dJ199H16.1

UniProt

Q14565

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DMC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQM

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_008999.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bahd1 3'UTR Luciferase Stable Cell Line
TU102512 1.0 mL

Bahd1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HAVCR1 Knockout KYSE30 Polyclonal Cells
ARG36300 1 Million

HAVCR1 Knockout KYSE30 Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral human RTP1 sgRNA gene knockout kit - Lentiviral human RTP1 sgRNA gene knockout kit (25)
GTR15360999 1 Vial

Lentiviral human RTP1 sgRNA gene knockout kit - Lentiviral human RTP1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Lentiviral mouse Robo1 shRNA (UAS) - Lentiviral mouse Robo1 shRNA (UAS, iRFP) (100)
GTR15301206 1 Vial

Lentiviral mouse Robo1 shRNA (UAS) - Lentiviral mouse Robo1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CXCL11 Rabbit Polyclonal Antibody (Cy5.5)
orb1049494 100 µL

CXCL11 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
mmu-miR-184-5p miRNA Inhibitor
MIM01282 2x 5.0 nmol

mmu-miR-184-5p miRNA Inhibitor

Sign In for Pricing
View Details