Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free BCA-1/CXCL13, Human (His)

The BCA-1/CXCL13 protein selectively attracts B lymphocytes without affecting T lymphocytes, monocytes, or neutrophils. Unlike other chemokines, it does not induce calcium release from B lymphocytes. Animal-Free BCA-1/CXCL13 Protein, Human (His) is the recombinant human-derived animal-FreeBCA-1/CXCL13 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BCA-1/CXCL13 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bca-1-cxcl13-protein-human-his.html

Purity

98.0

Smiles

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR

Molecular Formula

10563 (Gene_ID) O43927 (V23-R94) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxyprogesterone Impurity 30
RM-P157030-01 10 mg

Hydroxyprogesterone Impurity 30

Sign In for Pricing
View Details
Hydroxyprogesterone Impurity 30
RM-P157030-02 100 mg

Hydroxyprogesterone Impurity 30

Sign In for Pricing
View Details
Hydroxyprogesterone Impurity 30
RM-P157030-03 25 mg

Hydroxyprogesterone Impurity 30

Sign In for Pricing
View Details
Hydroxyprogesterone Impurity 30
RM-P157030-04 50 mg

Hydroxyprogesterone Impurity 30

Sign In for Pricing
View Details
Rat matrix metalloproteinase 10,MMP-10 ELISA KIT
JOT-EKA0024Ra 96 wells

Rat matrix metalloproteinase 10,MMP-10 ELISA KIT

Sign In for Pricing
View Details
TRPM4 inhibitor 8
T9776-01 5 mg

TRPM4 inhibitor 8

Sign In for Pricing
View Details