Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL33 Rabbit Polyclonal Antibody (FITC)

IL33 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DVS27, IL1F11, NF-HEV, NFEHEV, C9orf26

UniProt

O95760

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL33

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVE

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_005251684.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTP Inhibitor II
C3591-50000 50 g

PTP Inhibitor II

Sign In for Pricing
View Details
Human RalA Binding Protein 1 ELISA Kit
MBS071485-01 48 Well

Human RalA Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human RalA Binding Protein 1 ELISA Kit
MBS071485-02 96 Well

Human RalA Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human RalA Binding Protein 1 ELISA Kit
MBS071485-03 5x 96 Well

Human RalA Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human RalA Binding Protein 1 ELISA Kit
MBS071485-04 10x 96 Well

Human RalA Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
GAS2L3 Rabbit Polyclonal Antibody (HRP)
orb2104601 100 µL

GAS2L3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details