Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF3B Rabbit Polyclonal Antibody (HRP)

KIF3B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLA8, RP89, HH0048, KLP-11

UniProt

O15066

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIF3B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGGGGEEEEEEGEEGEEEGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEE

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_004789

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GF-1 Tissue Viral Nucleic Acid Extraction Kit (Proteinase K & Carrier RNA included), 50 preps
GF-TRD-050 50 Preparations

GF-1 Tissue Viral Nucleic Acid Extraction Kit (Proteinase K & Carrier RNA included), 50 preps

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/11), CF594 conjugate, 0.1mg/mL
BNC940011-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ENPP1 (NM_006208) Human Over-expression Lysate
LC401871 20 µg

ENPP1 (NM_006208) Human Over-expression Lysate

Sign In for Pricing
View Details
LIF (NM_002309) Human Over-expression Lysate
LY400835 100 µg

LIF (NM_002309) Human Over-expression Lysate

Sign In for Pricing
View Details
HSP27 (HSPB1) Human Gene Knockout Kit (CRISPR)
KN401800 1 Kit

HSP27 (HSPB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike S1+S2 ECD (L18F, T20N, P26S, D138Y, R190S, K417T, E484K, N501Y, D614G, H655Y, T1027I, V1176F) (His Tag)
PKSV030374 100 µg

Recombinant SARS-CoV-2 Spike S1+S2 ECD (L18F, T20N, P26S, D138Y, R190S, K417T, E484K, N501Y, D614G, H655Y, T1027I, V1176F) (His Tag)

Sign In for Pricing
View Details