Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAD2 Rabbit Polyclonal Antibody (HRP)

GAD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GAD65

UniProt

Q05329

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCE2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001127838

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Noradrenaline (NE) ELISA Kit-Sandwich
EK11F229-01 48 Test

Porcine Noradrenaline (NE) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Porcine Noradrenaline (NE) ELISA Kit-Sandwich
EK11F229-02 96 Tests

Porcine Noradrenaline (NE) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Anti-Human FGF23 Antibody (SAA0441), PerCP
HV625147-01 1 Each

Anti-Human FGF23 Antibody (SAA0441), PerCP

Sign In for Pricing
View Details
Anti-Human FGF23 Antibody (SAA0441), PerCP
HV625147-02 100 Tests

Anti-Human FGF23 Antibody (SAA0441), PerCP

Sign In for Pricing
View Details
MTERF2 (Transcription Termination Factor 2, Mitochondrial, Mitochondrial Transcription Termination Factor 2, mTERF2, Mitochondrial Transcription Termination Factor-like Protein, mTERF-like, mTERFL, mTERF Domain-containing Protein 3, Mitochondrial, MTERF2, MTERFD3)
406749-01 50 µL

MTERF2 (Transcription Termination Factor 2, Mitochondrial, Mitochondrial Transcription Termination Factor 2, mTERF2, Mitochondrial Transcription Termination Factor-like Protein, mTERF-like, mTERFL, mTERF Domain-containing Protein 3, Mitochondrial, MTERF2, MTERFD3)

Sign In for Pricing
View Details
MTERF2 (Transcription Termination Factor 2, Mitochondrial, Mitochondrial Transcription Termination Factor 2, mTERF2, Mitochondrial Transcription Termination Factor-like Protein, mTERF-like, mTERFL, mTERF Domain-containing Protein 3, Mitochondrial, MTERF2, MTERFD3)
406749-02 100 µL

MTERF2 (Transcription Termination Factor 2, Mitochondrial, Mitochondrial Transcription Termination Factor 2, mTERF2, Mitochondrial Transcription Termination Factor-like Protein, mTERF-like, mTERFL, mTERF Domain-containing Protein 3, Mitochondrial, MTERF2, MTERFD3)

Sign In for Pricing
View Details