Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO5 Rabbit Polyclonal Antibody (Biotin)

IPO5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IMB3, Pse1, imp5, KPNB3, RANBP5

UniProt

O00410

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IPO5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EDEDWANADELEDDDFDSNAVAGESALDRMACGLGGKLVLPMIKEHIMQM

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

120kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3R4, ID (PIK3R4, Phosphoinositide 3-kinase regulatory subunit 4, PI3-kinase p150 subunit, Phosphoinositide 3-kinase adaptor protein) (MaxLight 405)
MBS6334096-01 0.1 mL

PIK3R4, ID (PIK3R4, Phosphoinositide 3-kinase regulatory subunit 4, PI3-kinase p150 subunit, Phosphoinositide 3-kinase adaptor protein) (MaxLight 405)

Sign In for Pricing
View Details
PIK3R4, ID (PIK3R4, Phosphoinositide 3-kinase regulatory subunit 4, PI3-kinase p150 subunit, Phosphoinositide 3-kinase adaptor protein) (MaxLight 405)
MBS6334096-02 5x 0.1 mL

PIK3R4, ID (PIK3R4, Phosphoinositide 3-kinase regulatory subunit 4, PI3-kinase p150 subunit, Phosphoinositide 3-kinase adaptor protein) (MaxLight 405)

Sign In for Pricing
View Details
TSC2 Protein Vector (Mouse) (pPB-C-His)
PV242186 500 ng

TSC2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Porcine visfatin ELISA Kit
MBS165411-01 48 Well

Porcine visfatin ELISA Kit

Sign In for Pricing
View Details
Porcine visfatin ELISA Kit
MBS165411-02 96 Well

Porcine visfatin ELISA Kit

Sign In for Pricing
View Details
Porcine visfatin ELISA Kit
MBS165411-03 5x 96 Well

Porcine visfatin ELISA Kit

Sign In for Pricing
View Details