Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R12B Rabbit Polyclonal Antibody (FITC)

PPP1R12B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MYPT2, PP1bp55

UniProt

O60237

Immunogen

The immunogen for Anti-PPP1R12B antibody is: synthetic peptide directed towards the Middle region of Human MYPT2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPIRDRGSSIYRSSS

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

108 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLCO1A2 activation kit by CRISPRa
GA104497 1 Kit

Human SLCO1A2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human COPG2 activation kit by CRISPRa
GA108947 1 Kit

Human COPG2 activation kit by CRISPRa

Sign In for Pricing
View Details
TRAF3 (NM_145725) Human Over-expression Lysate
LC403439 20 µg

TRAF3 (NM_145725) Human Over-expression Lysate

Sign In for Pricing
View Details
TP53I13 Human Gene Knockout Kit (CRISPR)
KN400918 1 Kit

TP53I13 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAT1 (FAT atypical cadherin 1) (FAT1-3D7/1), 0.2mg/mL
BNUB2322-100 1x 100 µL

FAT1 (FAT atypical cadherin 1) (FAT1-3D7/1), 0.2mg/mL

Sign In for Pricing
View Details
Ferritin Polyclonal Antibody
E-AB-40577-01 25 µL

Ferritin Polyclonal Antibody

Sign In for Pricing
View Details