Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R12B Rabbit Polyclonal Antibody (HRP)

PPP1R12B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MYPT2, PP1bp55

UniProt

O60237

Immunogen

The immunogen for Anti-PPP1R12B antibody is: synthetic peptide directed towards the Middle region of Human MYPT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPIRDRGSSIYRSSS

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

108 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OneTaq DNA Polymerase
M0480L 1000 Units

OneTaq DNA Polymerase

Sign In for Pricing
View Details
Recombinant Human RRM2 Protein
ARP3790-01 10 µg

Recombinant Human RRM2 Protein

Sign In for Pricing
View Details
Recombinant Human RRM2 Protein
ARP3790-02 50 µg

Recombinant Human RRM2 Protein

Sign In for Pricing
View Details
Recombinant Human RRM2 Protein
ARP3790-03 100 µg

Recombinant Human RRM2 Protein

Sign In for Pricing
View Details
Recombinant Human RRM2 Protein
ARP3790-04 1 mg

Recombinant Human RRM2 Protein

Sign In for Pricing
View Details
LY6G6F Protein Vector (Mouse) (pPM-C-HA)
PV198276 500 ng

LY6G6F Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details