Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NHLH2 Rabbit Polyclonal Antibody (HRP)

NHLH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HEN2, NSCL2, bHLHa34

UniProt

Q02577

Immunogen

The immunogen for Anti-NHLH2 antibody is: synthetic peptide directed towards the N-terminal of Human HEN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_006710729.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5 Anti-Mouse CD162 Antibody
RD20538F-01 25 µg

PE/Cyanine5 Anti-Mouse CD162 Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD162 Antibody
RD20538F-02 100 µg

PE/Cyanine5 Anti-Mouse CD162 Antibody

Sign In for Pricing
View Details
FA2H sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
19631111 3x 1.0 µg

FA2H sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Il6ra/Interleukin-6 receptor subunit alpha ELISA Kit
E0786Mo 96 Tests

Mouse Il6ra/Interleukin-6 receptor subunit alpha ELISA Kit

Sign In for Pricing
View Details
P-PDGFR beta (Y1009) Antibody, mAb, Rabbit
A05098-50 50 µL

P-PDGFR beta (Y1009) Antibody, mAb, Rabbit

Sign In for Pricing
View Details
SRSF11 CRISPR All-in-one AAV vector set (with saCas9)(Human)
45514151 3x 1.0 µg DNA

SRSF11 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details