Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB3B Rabbit Polyclonal Antibody (HRP)

RAB3B Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P20337

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAB3B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVG

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_002858.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig Beta-Endorphin (bEP)(Competitive ELISA) ELISA Kit
MBS2140401-01 24 Strip Well

Pig Beta-Endorphin (bEP)(Competitive ELISA) ELISA Kit

Sign In for Pricing
View Details
Pig Beta-Endorphin (bEP)(Competitive ELISA) ELISA Kit
MBS2140401-02 48 Well

Pig Beta-Endorphin (bEP)(Competitive ELISA) ELISA Kit

Sign In for Pricing
View Details
Pig Beta-Endorphin (bEP)(Competitive ELISA) ELISA Kit
MBS2140401-03 96 Well

Pig Beta-Endorphin (bEP)(Competitive ELISA) ELISA Kit

Sign In for Pricing
View Details
Pig Beta-Endorphin (bEP)(Competitive ELISA) ELISA Kit
MBS2140401-04 5x 96 Well

Pig Beta-Endorphin (bEP)(Competitive ELISA) ELISA Kit

Sign In for Pricing
View Details
Pig Beta-Endorphin (bEP)(Competitive ELISA) ELISA Kit
MBS2140401-05 10x 96 Well

Pig Beta-Endorphin (bEP)(Competitive ELISA) ELISA Kit

Sign In for Pricing
View Details
Mouse NIPAL1 shRNA Plasmid
abx977280-01 150 µg

Mouse NIPAL1 shRNA Plasmid

Sign In for Pricing
View Details