Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRSF7 Rabbit Polyclonal Antibody (Biotin)

SRSF7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

9G8, AAG3, SFRS7

UniProt

Q16629

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SRSF7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSG

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF847P ORF Vector (Human) (pORF)
ORF036447 1.0 µg DNA

ZNF847P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
THRB Monoclonal Antibody, AbBy Fluor™ 350 Conjugated
bsm-41495M-BF350 100 µL

THRB Monoclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Echinococcus multilocularis (Em18) IgG ELISA
9310 96 Tests

Echinococcus multilocularis (Em18) IgG ELISA

Sign In for Pricing
View Details
Benchtop High Speed Centrifuge BCBH-305
BCBH-305 1 Unit

Benchtop High Speed Centrifuge BCBH-305

Sign In for Pricing
View Details
Trefoil Factor 3 (TFF3) (NM_003226) Human Tagged Lenti ORF Clone
RC223558L3 10 µg

Trefoil Factor 3 (TFF3) (NM_003226) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Prolyl Endopeptidase / PREP antibody
STJ70924 100 µg

Anti-Prolyl Endopeptidase / PREP antibody

Sign In for Pricing
View Details