Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRSF7 Rabbit Polyclonal Antibody (FITC)

SRSF7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

9G8, AAG3, SFRS7

UniProt

Q16629

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SRSF7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSG

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIPK1 (Homeodomain Interacting Protein Kinase 1, KIAA0630, MGC26642, MGC33446, MGC33548, Myak, Nbak2) (MaxLight 490)
247090-ML490 100 µL

HIPK1 (Homeodomain Interacting Protein Kinase 1, KIAA0630, MGC26642, MGC33446, MGC33548, Myak, Nbak2) (MaxLight 490)

Sign In for Pricing
View Details
Human LAIR1 Recombinant Protein, C-Fc
ARO-P20900-01 50 µg

Human LAIR1 Recombinant Protein, C-Fc

Sign In for Pricing
View Details
Human LAIR1 Recombinant Protein, C-Fc
ARO-P20900-02 100 µg

Human LAIR1 Recombinant Protein, C-Fc

Sign In for Pricing
View Details
Human LAIR1 Recombinant Protein, C-Fc
ARO-P20900-03 1 mg

Human LAIR1 Recombinant Protein, C-Fc

Sign In for Pricing
View Details
Sensor Analytical Balance
LX30SAB 1 Unit

Sensor Analytical Balance

Sign In for Pricing
View Details
SLC17A2 Antibody
orb127233-01 25 µg

SLC17A2 Antibody

Sign In for Pricing
View Details