Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRSF7 Rabbit Polyclonal Antibody (HRP)

SRSF7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

9G8, AAG3, SFRS7

UniProt

Q16629

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SRSF7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSG

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTX1, ID (Protein Deltex-1, Deltex1, hDTX1) (MaxLight 750)
MBS6473064-01 0.1 mL

DTX1, ID (Protein Deltex-1, Deltex1, hDTX1) (MaxLight 750)

Sign In for Pricing
View Details
DTX1, ID (Protein Deltex-1, Deltex1, hDTX1) (MaxLight 750)
MBS6473064-02 5x 0.1 mL

DTX1, ID (Protein Deltex-1, Deltex1, hDTX1) (MaxLight 750)

Sign In for Pricing
View Details
FXYD2 Antibody
orb678400 100 µL

FXYD2 Antibody

Sign In for Pricing
View Details
Anti-R Cadherin Rabbit Monoclonal Antibody, Carrier-free
M07632-1-carrier-free 100 µL

Anti-R Cadherin Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Mouse ATPase inhibitor, mitochondrial (ATPIF1) ELISA Kit
MBS7240836-01 48 Well

Mouse ATPase inhibitor, mitochondrial (ATPIF1) ELISA Kit

Sign In for Pricing
View Details
Mouse ATPase inhibitor, mitochondrial (ATPIF1) ELISA Kit
MBS7240836-02 96 Well

Mouse ATPase inhibitor, mitochondrial (ATPIF1) ELISA Kit

Sign In for Pricing
View Details