Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRA2B Rabbit Polyclonal Antibody (Biotin)

TRA2B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SFRS10, SRFS10, TRAN2B, PPP1R156, TRA2-BETA, Htra2-beta

UniProt

P62995

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRA2B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRD

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5' DNA Adenylation Kit
K1815-10 10 Reactionss

5' DNA Adenylation Kit

Sign In for Pricing
View Details
UHMK1 Antibody
orb1249202 0.1 mg

UHMK1 Antibody

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 2 (HSPA2)
MBS2069687-01 0.1 mL

HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 2 (HSPA2)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 2 (HSPA2)
MBS2069687-02 0.2 mL

HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 2 (HSPA2)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 2 (HSPA2)
MBS2069687-03 0.5 mL

HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 2 (HSPA2)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 2 (HSPA2)
MBS2069687-04 1 mL

HRP-Linked Monoclonal Antibody to Heat Shock 70kDa Protein 2 (HSPA2)

Sign In for Pricing
View Details