Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF7 Rabbit Polyclonal Antibody (FITC)

RNF7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SAG, ROC2, rbx2, CKBBP1

UniProt

Q9UBF6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBX2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDAC

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (3-fluorophenyl) -5-oxopyrrolidine-3-carboxylic acid
sc-281800 100 mg

1- (3-fluorophenyl) -5-oxopyrrolidine-3-carboxylic acid

Sign In for Pricing
View Details
CANT1 (Putative NF-kappa-B-activating Protein 107, Putative MAPK-activating Protein PM09, Apyrase Homolog, Soluble Calcium-activated Nucleotidase 1, SCAN-1, SHAPY) (MaxLight 405)
MBS6372151-01 0.1 mL

CANT1 (Putative NF-kappa-B-activating Protein 107, Putative MAPK-activating Protein PM09, Apyrase Homolog, Soluble Calcium-activated Nucleotidase 1, SCAN-1, SHAPY) (MaxLight 405)

Sign In for Pricing
View Details
CANT1 (Putative NF-kappa-B-activating Protein 107, Putative MAPK-activating Protein PM09, Apyrase Homolog, Soluble Calcium-activated Nucleotidase 1, SCAN-1, SHAPY) (MaxLight 405)
MBS6372151-02 5x 0.1 mL

CANT1 (Putative NF-kappa-B-activating Protein 107, Putative MAPK-activating Protein PM09, Apyrase Homolog, Soluble Calcium-activated Nucleotidase 1, SCAN-1, SHAPY) (MaxLight 405)

Sign In for Pricing
View Details
Mouse GUK1 siRNA
abx918951-01 15 nmol

Mouse GUK1 siRNA

Sign In for Pricing
View Details
Mouse GUK1 siRNA
abx918951-02 30 nmol

Mouse GUK1 siRNA

Sign In for Pricing
View Details
Lentiviral human SPANXN4 shRNA (UAS) - Lentiviral human SPANXN4 shRNA (UAS, iRFP) (100)
GTR15315750 1 Vial

Lentiviral human SPANXN4 shRNA (UAS) - Lentiviral human SPANXN4 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details