Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGK2 Rabbit Polyclonal Antibody (FITC)

SGK2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

H-SGK2, dJ138B7.2

UniProt

Q9HBY8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SGK2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PELPDHCYRMNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVI

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Glutathione Peroxidase 4 (GPX4), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0029686 96 Tests

Multiplex Assay Kit for Glutathione Peroxidase 4 (GPX4), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
PLV3-U6-Miox-shRNA5-Fluc-Neo Plasmid
PVT81209 2 µg

PLV3-U6-Miox-shRNA5-Fluc-Neo Plasmid

Sign In for Pricing
View Details
Lentiviral human ALDH3A2 sgRNA gene knockout kit - Lentiviral human ALDH3A2 sgRNA gene knockout kit (25)
GTR15378084 1 Vial

Lentiviral human ALDH3A2 sgRNA gene knockout kit - Lentiviral human ALDH3A2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM-3/HAVCR2 Protein (C-Fc-6His)
MBS2553269-01 0.01 mg

Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM-3/HAVCR2 Protein (C-Fc-6His)

Sign In for Pricing
View Details
Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM-3/HAVCR2 Protein (C-Fc-6His)
MBS2553269-02 0.05 mg

Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM-3/HAVCR2 Protein (C-Fc-6His)

Sign In for Pricing
View Details
Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM-3/HAVCR2 Protein (C-Fc-6His)
MBS2553269-03 5x 0.05 mg

Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM-3/HAVCR2 Protein (C-Fc-6His)

Sign In for Pricing
View Details