Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGK2 Rabbit Polyclonal Antibody (FITC)

SGK2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

H-SGK2, dJ138B7.2

UniProt

Q9HBY8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SGK2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PELPDHCYRMNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVI

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tripartite Motif-Containing Protein 29 ELISA Kit
MBS3804074-01 48 Well

Human Tripartite Motif-Containing Protein 29 ELISA Kit

Sign In for Pricing
View Details
Human Tripartite Motif-Containing Protein 29 ELISA Kit
MBS3804074-02 96 Well

Human Tripartite Motif-Containing Protein 29 ELISA Kit

Sign In for Pricing
View Details
Human Tripartite Motif-Containing Protein 29 ELISA Kit
MBS3804074-03 5x 96 Well

Human Tripartite Motif-Containing Protein 29 ELISA Kit

Sign In for Pricing
View Details
Human Tripartite Motif-Containing Protein 29 ELISA Kit
MBS3804074-04 10x 96 Well

Human Tripartite Motif-Containing Protein 29 ELISA Kit

Sign In for Pricing
View Details
Mouse Human Bence Jones kappa (surface and hidden determinants), conjugated with FITC Antibody
orb21179 0.2 mg

Mouse Human Bence Jones kappa (surface and hidden determinants), conjugated with FITC Antibody

Sign In for Pricing
View Details
Cardboard box B9, 50 mm, 133x133x50 mm incl 9x9 cells
TE22230 36 Cases

Cardboard box B9, 50 mm, 133x133x50 mm incl 9x9 cells

Sign In for Pricing
View Details