Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGK2 Rabbit Polyclonal Antibody (HRP)

SGK2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H-SGK2, dJ138B7.2

UniProt

Q9HBY8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SGK2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PELPDHCYRMNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVI

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SPDYA shRNA (UAS) - Lentiviral human SPDYA shRNA (UAS, RFP) plasmid
GTR15099817 1 Vial

Lentiviral human SPDYA shRNA (UAS) - Lentiviral human SPDYA shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Human Pre-mRNA-splicing regulator WTAP (WTAP) ELISA Kit
AE11088HU-01 48 Tests

Human Pre-mRNA-splicing regulator WTAP (WTAP) ELISA Kit

Sign In for Pricing
View Details
Human Pre-mRNA-splicing regulator WTAP (WTAP) ELISA Kit
AE11088HU-02 96 Tests

Human Pre-mRNA-splicing regulator WTAP (WTAP) ELISA Kit

Sign In for Pricing
View Details
STK32C 3'UTR GFP Stable Cell Line
TU074824 1.0 mL

STK32C 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ATP5MD (NM_032747) Human Untagged Clone
SC103736 10 µg

ATP5MD (NM_032747) Human Untagged Clone

Sign In for Pricing
View Details
Rat Monoclonal GITR/TNFRSF18 Antibody (RM0066-7C13) [Alexa Fluor 350]
NBP2-12338AF350 0.1 mL

Rat Monoclonal GITR/TNFRSF18 Antibody (RM0066-7C13) [Alexa Fluor 350]

Sign In for Pricing
View Details