Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNPH1 Rabbit Polyclonal Antibody (HRP)

DNPH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RCL, C6orf108, dJ330M21.3

UniProt

O43598

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DNPH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPT

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Fatty Acid Desaturase 3 ELISA Kit
MBS074461-01 48 Well

Hamster Fatty Acid Desaturase 3 ELISA Kit

Sign In for Pricing
View Details
Hamster Fatty Acid Desaturase 3 ELISA Kit
MBS074461-02 96 Well

Hamster Fatty Acid Desaturase 3 ELISA Kit

Sign In for Pricing
View Details
Hamster Fatty Acid Desaturase 3 ELISA Kit
MBS074461-03 5x 96 Well

Hamster Fatty Acid Desaturase 3 ELISA Kit

Sign In for Pricing
View Details
Hamster Fatty Acid Desaturase 3 ELISA Kit
MBS074461-04 10x 96 Well

Hamster Fatty Acid Desaturase 3 ELISA Kit

Sign In for Pricing
View Details
TNRC6A Polyclonal Antibody
A72897-050 50 µL

TNRC6A Polyclonal Antibody

Sign In for Pricing
View Details
Anti-DISC1 (NT) Polyclonal Antibody
TMAB-05170-01 50 μL

Anti-DISC1 (NT) Polyclonal Antibody

Sign In for Pricing
View Details