Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHP1 Rabbit Polyclonal Antibody (HRP)

CHP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CHP, p22, p24, SPAX9, Sid470p, SLC9A1BP

UniProt

Q99653

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CHP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNK

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_009167

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX9 / SRY-box 9 (SOX9/2287R), CF568 conjugate, 0.1mg/mL
BNC682287-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2287R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse Prostasin/PRSS8 Protein (aa 30-289, His Tag)
PKSM040855 50 µg

Recombinant Mouse Prostasin/PRSS8 Protein (aa 30-289, His Tag)

Sign In for Pricing
View Details
QuicKey Pro Human PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit
E-OSEL-H0070-01 24 Tests

QuicKey Pro Human PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit
E-OSEL-H0070-02 48 Tests

QuicKey Pro Human PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit
E-OSEL-H0070-03 96 Tests

QuicKey Pro Human PDGF-BB (Platelet Derived Growth Factor BB) ELISA Kit

Sign In for Pricing
View Details
Recombinant STAT5b Monoclonal Antibody
E-AB-81513-01 50 µL

Recombinant STAT5b Monoclonal Antibody

Sign In for Pricing
View Details