Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX12 Rabbit Polyclonal Antibody (HRP)

STX12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

STX13, STX14

UniProt

Q86Y82

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human STX12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQ

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_803173.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tas2r124 Rat shRNA Plasmid (Locus ID 690472)
TL704010 1 Kit

Tas2r124 Rat shRNA Plasmid (Locus ID 690472)

Sign In for Pricing
View Details
SLC27A2 antibody - N-terminal region (ARP43855_P050)
ARP43855_P050 100 µL

SLC27A2 antibody - N-terminal region (ARP43855_P050)

Sign In for Pricing
View Details
Canine G-protein coupled receptor 39 (GPR39) ELISA Kit
MBS7239443-01 48 Well

Canine G-protein coupled receptor 39 (GPR39) ELISA Kit

Sign In for Pricing
View Details
Canine G-protein coupled receptor 39 (GPR39) ELISA Kit
MBS7239443-02 96 Well

Canine G-protein coupled receptor 39 (GPR39) ELISA Kit

Sign In for Pricing
View Details
Canine G-protein coupled receptor 39 (GPR39) ELISA Kit
MBS7239443-03 5x 96 Well

Canine G-protein coupled receptor 39 (GPR39) ELISA Kit

Sign In for Pricing
View Details
Canine G-protein coupled receptor 39 (GPR39) ELISA Kit
MBS7239443-04 10x 96 Well

Canine G-protein coupled receptor 39 (GPR39) ELISA Kit

Sign In for Pricing
View Details