Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFIP11 Rabbit Polyclonal Antibody (Biotin)

TFIP11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NTR1, STIP, TIP39, STIP-1, Spp382, bK445C9.6

UniProt

Q9UBB9

Immunogen

The immunogen for Anti-TFIP11 antibody is: synthetic peptide directed towards the N-terminal region of Human TFP11

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QKELSQWRKDPSGSKKKPKYSYKTVEELKAKGRISKKLTAPQKELSQVKV

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

92 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (FITC)
MBS6177359-01 0.1 mL

TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (FITC)

Sign In for Pricing
View Details
TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (FITC)
MBS6177359-02 5x 0.1 mL

TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (FITC)

Sign In for Pricing
View Details
GATA1 (NM_002049) Human Mutant ORF Clone
RC402610 10 µg

GATA1 (NM_002049) Human Mutant ORF Clone

Sign In for Pricing
View Details
CD229 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-2529R-PerCP-Cy5.5 100 µL

CD229 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Porcine Rheumatoid Factor ELISA Kit
GTR10361767 96 Well

Porcine Rheumatoid Factor ELISA Kit

Sign In for Pricing
View Details
Porcine Alpha-1, 6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase A (MGAT5) ELISA Kit
MBS9932738-01 48 Well

Porcine Alpha-1, 6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase A (MGAT5) ELISA Kit

Sign In for Pricing
View Details