Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFIP11 Rabbit Polyclonal Antibody (HRP)

TFIP11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NTR1, STIP, TIP39, STIP-1, Spp382, bK445C9.6

UniProt

Q9UBB9

Immunogen

The immunogen for Anti-TFIP11 antibody is: synthetic peptide directed towards the N-terminal region of Human TFP11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QKELSQWRKDPSGSKKKPKYSYKTVEELKAKGRISKKLTAPQKELSQVKV

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

92 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCE3A 3'UTR Lenti-reporter-Luc Vector
26358081 1.0 µg

LCE3A 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Olr78 3'UTR GFP Stable Cell Line
TU265478 1.0 mL

Olr78 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Chromogranin B Rabbit Polyclonal Antibody (RBITC)
orb1054869 100 µL

Chromogranin B Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Anti-Human SCD5 Polyclonal Antibody
HC065014-01 50 µg

Anti-Human SCD5 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human SCD5 Polyclonal Antibody
HC065014-02 100 µg

Anti-Human SCD5 Polyclonal Antibody

Sign In for Pricing
View Details
C3AR1 Protein Vector (Rat) (pPM-C-HA)
PV256932 500 ng

C3AR1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details