Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3MBTL1 Rabbit Polyclonal Antibody (FITC)

L3MBTL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L3MBTL, ZC2HC3, H-L (3) MBT, dJ138B7.3

UniProt

Q9Y468

Immunogen

The immunogen for Anti-L3MBTL1 antibody is: synthetic peptide directed towards the N-terminal of Human LMBL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHS

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC728109 (G-2)
sc-515290 200 µg/mL

LOC728109 (G-2)

Sign In for Pricing
View Details
Human HP Knockout HEK293T cell line
GTR15413902 1 Vial

Human HP Knockout HEK293T cell line

Sign In for Pricing
View Details
Lentiviral mouse Abraxas1 shRNA (UAS) - Lentiviral mouse Abraxas1 shRNA (UAS, RFP) (25)
GTR15292151 1 Vial

Lentiviral mouse Abraxas1 shRNA (UAS) - Lentiviral mouse Abraxas1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
TNNI3 Antibody (Biotin)
orb238659-01 50 µg

TNNI3 Antibody (Biotin)

Sign In for Pricing
View Details
TNNI3 Antibody (Biotin)
orb238659-02 100 µg

TNNI3 Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Porphyromonas gingivalis Cell division protein FtsZ (ftsZ)
orb1674766-01 20 µg

Recombinant Porphyromonas gingivalis Cell division protein FtsZ (ftsZ)

Sign In for Pricing
View Details