Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBGCP4 Rabbit Polyclonal Antibody (Biotin)

TUBGCP4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

76P, GCP4, GCP-4, Grip76, MCCRP3

UniProt

Q9UGJ1

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GCP4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KGFSRQSSLLFKILSSVRNHQINSDLAQLLLRLDYNKYYTQAGGTLGSFG

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human cluster of differentiation 19 (CD19) Elisa Kit
EK710098 96 Well

Human cluster of differentiation 19 (CD19) Elisa Kit

Sign In for Pricing
View Details
Rb Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2434877 100 µL

Rb Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Parkinson Disease Protein 2 (PARK2)
MBS2137777-01 0.1 mL

APC_Cy7 Linked Polyclonal Antibody to Parkinson Disease Protein 2 (PARK2)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Parkinson Disease Protein 2 (PARK2)
MBS2137777-02 0.2 mL

APC_Cy7 Linked Polyclonal Antibody to Parkinson Disease Protein 2 (PARK2)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Parkinson Disease Protein 2 (PARK2)
MBS2137777-03 0.5 mL

APC_Cy7 Linked Polyclonal Antibody to Parkinson Disease Protein 2 (PARK2)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Parkinson Disease Protein 2 (PARK2)
MBS2137777-04 1 mL

APC_Cy7 Linked Polyclonal Antibody to Parkinson Disease Protein 2 (PARK2)

Sign In for Pricing
View Details