Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Granzyme B/GZMB, Human (HEK293, His)

Granzyme B (GZMB) is a cytosolic protease enriched in cytotoxic T cells and natural killer cells and is critical for immune defense. Upon delivery to target cells, GZMB activates caspase-independent pyroptosis by cleaving gasdermin-E (GSDME) . Granzyme B/GZMB Protein, Human (HEK293, His) is the recombinant human-derived Granzyme B/GZMB protein, expressed by HEK293, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Granzyme B/GZMB Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/granzyme-b-gzmb-protein-human-227a-a-hek293-his.html

Purity

98.0

Smiles

IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

Molecular Formula

3002 (Gene_ID) P10144 (I21-Y247) (Accession)

Molecular Weight

Predicted band size: 26.6 kDa; Observed band size: 32-42 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rhot1 shRNA (UAS) - Lentiviral mouse Rhot1 shRNA (UAS, RFP) (25)
GTR15296786 1 Vial

Lentiviral mouse Rhot1 shRNA (UAS) - Lentiviral mouse Rhot1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
CD5 Mouse mAb Antibody
orb763435-01 50 μL

CD5 Mouse mAb Antibody

Sign In for Pricing
View Details
CD5 Mouse mAb Antibody
orb763435-02 100 µL

CD5 Mouse mAb Antibody

Sign In for Pricing
View Details
GNB2L1 Protein Lysate (Human) with C-Ha Tag
22313031 100 µg

GNB2L1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Exoc6 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3427903 1.0 µg DNA

Exoc6 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
AdmiRa-Off-mmu-miR-6925-3p Virus
mm6390 1.0 mL

AdmiRa-Off-mmu-miR-6925-3p Virus

Sign In for Pricing
View Details