Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UIMC1 Rabbit Polyclonal Antibody (HRP)

UIMC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAP80, X2HRIP110

UniProt

Q96RL1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human UIMC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GEQASEKNECISEDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKL

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (HRP)
MBS6403647-01 0.1 mL

Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (HRP)

Sign In for Pricing
View Details
Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (HRP)
MBS6403647-02 5x 0.1 mL

Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (HRP)

Sign In for Pricing
View Details
DDX19B, Control Peptide (ATP-dependent RNA Helicase DDX19B, DEAD Box RNA Helicase DEAD5, DEAD Box Protein 19B, DBP5, DDX19, TDBP)
147827 100 µg

DDX19B, Control Peptide (ATP-dependent RNA Helicase DDX19B, DEAD Box RNA Helicase DEAD5, DEAD Box Protein 19B, DBP5, DDX19, TDBP)

Sign In for Pricing
View Details
APOO Knockout HT29 Polyclonal Cells
ARG32996 1 Million

APOO Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Ras modification protein erf4 (erf4)
MBS1454923-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Ras modification protein erf4 (erf4)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Ras modification protein erf4 (erf4)
MBS1454923-02 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Ras modification protein erf4 (erf4)

Sign In for Pricing
View Details