Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLST8 Rabbit Polyclonal Antibody (HRP)

MLST8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GBL, LST8, POP3, WAT1, GbetaL

UniProt

Q9BVC4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LST8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGV

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNNI2 Mouse Monoclonal Antibody
AMM81047-01 1 Each

TNNI2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TNNI2 Mouse Monoclonal Antibody
AMM81047-02 50 µL

TNNI2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TNNI2 Mouse Monoclonal Antibody
AMM81047-03 100 µL

TNNI2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ZNF350 (Zinc Finger Protein 350, KRAB Zinc Finger Protein ZFQR, ZFQR, Zinc Finger and BRCA1-interacting Protein with a KRAB Domain 1, Zinc Finger Protein ZBRK1, ZBRK1) (MaxLight 750)
MBS6399193-01 0.1 mL

ZNF350 (Zinc Finger Protein 350, KRAB Zinc Finger Protein ZFQR, ZFQR, Zinc Finger and BRCA1-interacting Protein with a KRAB Domain 1, Zinc Finger Protein ZBRK1, ZBRK1) (MaxLight 750)

Sign In for Pricing
View Details
ZNF350 (Zinc Finger Protein 350, KRAB Zinc Finger Protein ZFQR, ZFQR, Zinc Finger and BRCA1-interacting Protein with a KRAB Domain 1, Zinc Finger Protein ZBRK1, ZBRK1) (MaxLight 750)
MBS6399193-02 5x 0.1 mL

ZNF350 (Zinc Finger Protein 350, KRAB Zinc Finger Protein ZFQR, ZFQR, Zinc Finger and BRCA1-interacting Protein with a KRAB Domain 1, Zinc Finger Protein ZBRK1, ZBRK1) (MaxLight 750)

Sign In for Pricing
View Details
NVP-BHG712 isomer 10mM * 1mL in DMSO
A21426-10mM-D 10 mM x 1mL in DMSO

NVP-BHG712 isomer 10mM * 1mL in DMSO

Sign In for Pricing
View Details