Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKAP1 Rabbit Polyclonal Antibody (HRP)

MAPKAP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MIP1, SIN1, JC310, SIN1b, SIN1g

UniProt

Q9BPZ7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SIN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKKSLKEKPPISGKQSILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTAT

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOSC9 sgRNA CRISPR Lentivector set (Human)
K0704301 3x 1.0 µg

EXOSC9 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Tryptophan Hydroxylase/TPH1 Rabbit Polyclonal Antibody (Fluoro594)
orb3113342 100 µg

Tryptophan Hydroxylase/TPH1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Cers4 AAV siRNA Pooled Vector
15932166 1.0 µg

Cers4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rat Ggt1 Pre-designed siRNA Set B
SI205549B 1 Each

Rat Ggt1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
NDST3, CT (NDST3, HSST3, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3, Glucosaminyl N-deacetylase/N-sulfotransferase 3, N-heparan sulfate sulfotransferase 3, Heparan sulfate N-deacetylase 3, Heparan sulfate N-sulfotransferase 3) (MaxLig
MBS6324316-01 0.1 mL

NDST3, CT (NDST3, HSST3, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3, Glucosaminyl N-deacetylase/N-sulfotransferase 3, N-heparan sulfate sulfotransferase 3, Heparan sulfate N-deacetylase 3, Heparan sulfate N-sulfotransferase 3) (MaxLig

Sign In for Pricing
View Details
NDST3, CT (NDST3, HSST3, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3, Glucosaminyl N-deacetylase/N-sulfotransferase 3, N-heparan sulfate sulfotransferase 3, Heparan sulfate N-deacetylase 3, Heparan sulfate N-sulfotransferase 3) (MaxLig
MBS6324316-02 5x 0.1 mL

NDST3, CT (NDST3, HSST3, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3, Glucosaminyl N-deacetylase/N-sulfotransferase 3, N-heparan sulfate sulfotransferase 3, Heparan sulfate N-deacetylase 3, Heparan sulfate N-sulfotransferase 3) (MaxLig

Sign In for Pricing
View Details