Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAAF1 Rabbit Polyclonal Antibody (HRP)

DNAAF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Swt, DAU1, ODA7, CILD13, LRRC50

UniProt

Q8NEP3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DAAF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VGSSDTSYHSQQKQSGDNGSGGHFAHPREDREDRGPRMTKSSLQKLCKQH

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human heat shock protein 27, HSP-27 ELISA Kit
YLA1853HU-01 48 Tests

Human heat shock protein 27, HSP-27 ELISA Kit

Sign In for Pricing
View Details
Human heat shock protein 27, HSP-27 ELISA Kit
YLA1853HU-02 96 Tests

Human heat shock protein 27, HSP-27 ELISA Kit

Sign In for Pricing
View Details
CYBB (Cytochrome b-245 Heavy Chain, CGD, GP91-1, GP91-PHOX, GP91PHOX, NOX2, p91-PHOX) (Biotin)
MBS6413287-01 0.1 mL

CYBB (Cytochrome b-245 Heavy Chain, CGD, GP91-1, GP91-PHOX, GP91PHOX, NOX2, p91-PHOX) (Biotin)

Sign In for Pricing
View Details
CYBB (Cytochrome b-245 Heavy Chain, CGD, GP91-1, GP91-PHOX, GP91PHOX, NOX2, p91-PHOX) (Biotin)
MBS6413287-02 5x 0.1 mL

CYBB (Cytochrome b-245 Heavy Chain, CGD, GP91-1, GP91-PHOX, GP91PHOX, NOX2, p91-PHOX) (Biotin)

Sign In for Pricing
View Details
Recombinant Cynomolgus Monkey NDP Protein, His (Fc)-Avi-tagged
NDP-475C 50 µg

Recombinant Cynomolgus Monkey NDP Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
OAS1 Polyclonal Antibody
MBS2534736-01 0.06 mL

OAS1 Polyclonal Antibody

Sign In for Pricing
View Details